DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and LysX

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_523881.1 Gene:LysX / 38122 FlyBaseID:FBgn0004431 Length:142 Species:Drosophila melanogaster


Alignment Length:125 Identity:44/125 - (35%)
Similarity:61/125 - (48%) Gaps:10/125 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KLLTRCQLAKELLRHDFPRSYLSNWVCLVEAESGRSTSKSMQLPNQ--SVSYGLFQINSKNWCR- 89
            :.:.||.||:|:......|..||.|.|:.|.||...|. .:..||.  |..||:||||...||: 
  Fly    20 RTMDRCSLAREMANMGVSRDQLSKWACIAEHESSYRTG-VVGPPNTDGSNDYGIFQINDMYWCQP 83

  Fly    90 ---KGRRGGICNIKCEEFLNDEISDDSRCAMQIFNRHGFQAWPGWMSKCRGRTLPDVSRC 146
               |....| |::.|...|.|:|....|||:::..:.|:.||..| ..|.| .||.:..|
  Fly    84 SSGKFSHNG-CDVSCNALLTDDIKSSVRCALKVLGQQGWSAWSTW-HYCSG-YLPPIDDC 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 43/123 (35%)
LysXNP_523881.1 lysozyme_like 20..140 CDD:294153 43/123 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458902
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
76.860

Return to query results.
Submit another query.