DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and CG16799

DIOPT Version :10

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_611504.2 Gene:CG16799 / 37340 FlyBaseID:FBgn0034538 Length:179 Species:Drosophila melanogaster


Alignment Length:132 Identity:65/132 - (49%)
Similarity:91/132 - (68%) Gaps:2/132 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VLNLLLLSQWETESKLLTRCQLAKELL-RHDFPRSYLSNWVCLVEAESGRSTSKSMQLPNQSVSY 77
            ||.||.|...:.|||...||:|.:.|: .::|.::::|||:||||.||...|:|..:..|:|.:|
  Fly    27 VLILLQLGIEQVESKKYQRCELTRVLVENYNFDKTFISNWICLVEHESYLDTTKVTKKGNESKNY 91

  Fly    78 GLFQINSKNWCRKGRRGGICNIKCEEFLNDEISDDSRCAMQIFNRHGFQAWPGWMSKCRG-RTLP 141
            ||||||||::|.:||:||.||:|||:|.||:||||..||..|..|.||:.|.||...||. :.||
  Fly    92 GLFQINSKDYCSEGRKGGQCNMKCEDFSNDDISDDIACARMIQEREGFKYWKGWDRFCRNPQNLP 156

  Fly   142 DV 143
            ::
  Fly   157 NL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 58/118 (49%)
CG16799NP_611504.2 LYZ_C_invert 41..158 CDD:381618 58/116 (50%)

Return to query results.
Submit another query.