DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and Lyzl4

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:XP_006244185.3 Gene:Lyzl4 / 363168 RGDID:1308401 Length:265 Species:Rattus norvegicus


Alignment Length:142 Identity:50/142 - (35%)
Similarity:70/142 - (49%) Gaps:18/142 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LFLVLNLLLLSQWETE--SKLLTRCQLAKELLRHDFPRSY-----LSNWVCLVEAESGRSTSKSM 68
            |:||  |||:|...|.  :.:|.||.:||:|  :|...:|     |.|||||...||..:.|...
  Rat   123 LYLV--LLLISYLLTPIGASILGRCVVAKKL--YDGGLNYFEGYSLENWVCLAYFESKFNPSAVY 183

  Fly    69 QLPNQ-SVSYGLFQINSKNWCRKGRRGGICNIKCEEFLNDEISDDSRCAMQIF-NRHGFQAWPGW 131
            :.... |..:|||||....||..|:  .:|::.|...||..:.|...||.:|. .:.|..|||.|
  Rat   184 ENSRDGSTGFGLFQIRDNEWCDHGK--NLCSVSCTALLNPNLKDTIECAKKIVKGKQGMGAWPVW 246

  Fly   132 MSKCRGRTLPDV 143
            ...|:   |.|:
  Rat   247 SRNCQ---LSDI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 42/123 (34%)
Lyzl4XP_006244185.3 LYZ_C 141..263 CDD:340383 42/122 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347512
Domainoid 1 1.000 89 1.000 Domainoid score I7645
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I4956
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.