DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and RGD1306474

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001102216.1 Gene:RGD1306474 / 362881 RGDID:1306474 Length:151 Species:Rattus norvegicus


Alignment Length:137 Identity:47/137 - (34%)
Similarity:70/137 - (51%) Gaps:11/137 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVLNLLLLSQWETESKLLTRCQLAKELLRH---DFPRSYLSNWVCLVEAESGRSTSKSMQL--PN 72
            |.|.||||| ...:.|:|.||.||:.|.|.   .|....|:||:||.::.||..| |:::.  .:
  Rat     8 LTLGLLLLS-ITVQGKVLNRCLLARTLQRFGLGGFKGISLANWICLAKSVSGYDT-KAIKYNHED 70

  Fly    73 QSVSYGLFQINSKNWCRKGRRGG---ICNIKCEEFLNDEISDDSRCAMQIF-NRHGFQAWPGWMS 133
            :|.:||:|||:|:.||...:..|   .|.:.|:..|.:.|.....||.:|. :..|...|..|..
  Rat    71 RSTNYGIFQISSRYWCNDSKTPGSKNFCRVSCKALLKNNIKASVTCAKRIVKDPRGITTWEAWRK 135

  Fly   134 KCRGRTL 140
            .|..:.|
  Rat   136 NCEHKNL 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 40/122 (33%)
RGD1306474NP_001102216.1 LYZ1 22..149 CDD:197612 40/122 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347585
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8909
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.