DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and CG16756

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster


Alignment Length:143 Identity:64/143 - (44%)
Similarity:88/143 - (61%) Gaps:6/143 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PKGGALFLVLNLLLLSQWE---TESKLLTRCQLAKELL-RHDFPRSYLSNWVCLVEAESGRSTSK 66
            |.|...:|.|.|.||...|   ..:|...||:||::|| :|.|.||.||||:||:|.||...|.:
  Fly     5 PFGSWYWLGLGLGLLLAIECGVVSAKRFLRCELARKLLDQHGFERSLLSNWICLLEHESDLDTGR 69

  Fly    67 SMQLPNQSVSYGLFQINSKNWCRKGRRGGICNIKCEEFLNDEISDDSRCAMQIFNRHGFQAWPGW 131
            .....|.|.:|||||||.: :|::||||||||.|||:||::.:.:...||.:|....||:.|.||
  Fly    70 ITTNANGSRNYGLFQINGR-FCQEGRRGGICNAKCEDFLDENLRESVTCAKRIQTSDGFRHWAGW 133

  Fly   132 MSKCR-GRTLPDV 143
            ...|| .:.||::
  Fly   134 QRYCRNAQNLPNL 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 56/118 (47%)
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 55/115 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468855
Domainoid 1 1.000 81 1.000 Domainoid score I8440
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5137
Isobase 1 0.950 - 0 Normalized mean entropy S7264
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - otm26024
orthoMCL 1 0.900 - - OOG6_113391
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
1312.760

Return to query results.
Submit another query.