DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and Spaca5

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001101528.1 Gene:Spaca5 / 314431 RGDID:1584964 Length:160 Species:Rattus norvegicus


Alignment Length:136 Identity:45/136 - (33%)
Similarity:72/136 - (52%) Gaps:8/136 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVLNLLLLSQWETESKLLTRCQLAKELLR---HDFPRSYLSNWVCLVEAESGRSTSKSMQLPNQS 74
            ::|..|||:  ..::|:..||:||::|.:   :.|....:.:|:|:...|||..||.....|:.|
  Rat     9 VILATLLLA--TVDAKIYERCELARKLEKAGLNGFKGYTVGDWLCVAHYESGFDTSFVDHNPDGS 71

  Fly    75 VSYGLFQINSKNWCRKG--RRGGICNIKCEEFLNDEISDDSRCAMQIFNRH-GFQAWPGWMSKCR 136
            ..||:||:||..||..|  ....:|::.|.:.||..|.||..||.::.:.| ..:||..|...|.
  Rat    72 SEYGIFQLNSAWWCNNGITPTQNLCHMDCNDLLNRHILDDIMCAKRVVSSHKSMKAWDSWTRHCA 136

  Fly   137 GRTLPD 142
            |..|.:
  Rat   137 GHDLSE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 41/121 (34%)
Spaca5NP_001101528.1 LYZ_C 22..147 CDD:340383 41/121 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347603
Domainoid 1 1.000 89 1.000 Domainoid score I7645
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I4956
OMA 1 1.010 - - QHG46733
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8909
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.