DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and Spaca3

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001099290.1 Gene:Spaca3 / 287557 RGDID:1306684 Length:163 Species:Rattus norvegicus


Alignment Length:146 Identity:52/146 - (35%)
Similarity:78/146 - (53%) Gaps:14/146 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALFLVLNLLLLSQWETESKLLTRCQLAKELLRHDFP----RSY-LSNWVCLVEAESGRSTSKSMQ 69
            ||..:|:.||.|   :::|:.:||:|||.|  |||.    |.| |::|:||....||.:|.....
  Rat    21 ALAYLLSCLLAS---SKAKVFSRCELAKVL--HDFGLEGYRGYNLADWICLAYYTSGFNTDAVDH 80

  Fly    70 LPNQSVSYGLFQINSKNWCRKGRRGG--ICNIKCEEFLNDEISDDSRCAMQIFNR-HGFQAWPGW 131
            ..:.|.:.|:|||:|:.||:.....|  :|.|.|.:.|::::.|...|.|:|... .|...|..|
  Rat    81 EADGSTNNGIFQISSRKWCKNLAPNGPNLCRIYCTDLLSNDLKDSVACVMKIAQEPQGLGYWESW 145

  Fly   132 MSKCRGRTLPD-VSRC 146
            ...|:||.|.| |..|
  Rat   146 KHHCQGRDLSDWVDGC 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 45/126 (36%)
Spaca3NP_001099290.1 LYZ_C 36..161 CDD:340383 45/126 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347600
Domainoid 1 1.000 89 1.000 Domainoid score I7645
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I4956
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8909
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.