DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and Spaca5

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001078862.1 Gene:Spaca5 / 278203 MGIID:2685564 Length:160 Species:Mus musculus


Alignment Length:136 Identity:47/136 - (34%)
Similarity:72/136 - (52%) Gaps:8/136 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVLNLLLLSQWETESKLLTRCQLAKELLR---HDFPRSYLSNWVCLVEAESGRSTSKSMQLPNQS 74
            ::|.:||::  :.::|:..||:|||:|..   ..|....:.:|:|:...|||..||.....|:.|
Mouse     9 VILAVLLIA--KLDAKIYERCELAKKLEEAGLDGFKGYTVGDWLCVAHYESGFDTSFVDHNPDGS 71

  Fly    75 VSYGLFQINSKNWCRKG--RRGGICNIKCEEFLNDEISDDSRCAMQIFNRH-GFQAWPGWMSKCR 136
            ..||:||:||..||..|  ....:|||.|.:.||..|.||..||.::.:.| ..:||..|...|.
Mouse    72 SEYGIFQLNSAWWCNNGITPTQNLCNIDCNDLLNRHILDDIICAKRVASSHKSMKAWDSWTQHCA 136

  Fly   137 GRTLPD 142
            |..|.:
Mouse   137 GHDLSE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 44/121 (36%)
Spaca5NP_001078862.1 LYZ1 22..145 CDD:238066 44/121 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844239
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7264
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8674
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4912
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.