DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and CG30062

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster


Alignment Length:123 Identity:43/123 - (34%)
Similarity:61/123 - (49%) Gaps:7/123 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LTRCQLAKELLRHDFPRSYLSNWVCLVEAESGRSTSKSMQL-PNQSVSYGLFQINSKNWCRKGRR 93
            |..|:||.:|...|.|:|.|..|:|:.|.||..:|....|. .:.|..||||||:.:.||....|
  Fly    29 LQPCELAGQLYILDVPKSELPLWLCIAEFESRFNTHVVGQANADGSRDYGLFQISDRYWCAPPNR 93

  Fly    94 G-----GICNIKCEEFLNDEISDDSRCAMQIFNRHGFQAWPGWMSKCRGRTLPDVSRC 146
            .     ..||:.|...|:|:|:...:||..|..:.|:.||..:...|.| ||..:..|
  Fly    94 TEYYAFNDCNVNCTHLLSDDITMAVQCARLIQKQQGWTAWSVYPEFCNG-TLDAIDVC 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 42/121 (35%)
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 41/118 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458911
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
65.850

Return to query results.
Submit another query.