DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and Lalba

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_036726.1 Gene:Lalba / 24528 RGDID:2987 Length:159 Species:Rattus norvegicus


Alignment Length:128 Identity:40/128 - (31%)
Similarity:66/128 - (51%) Gaps:5/128 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FLVLNLLLLSQWETESKLLTRCQLAKELLRHD-FPRSYLSNWVCLVEAESGRSTSKSMQLPNQSV 75
            |:.|.|..:|....::...|:|:::..:...| :....|..|.|::...||.. |:::...|.|.
  Rat     4 FVPLFLACISLPAFQATEFTKCEVSHAIEDMDGYQGISLLEWTCVLFHTSGYD-SQAIVKNNGST 67

  Fly    76 SYGLFQINSKNWCRKG---RRGGICNIKCEEFLNDEISDDSRCAMQIFNRHGFQAWPGWMSKC 135
            .||||||:::|||:..   ....||:|.|::||:||::||..||.:|....|...|......|
  Rat    68 EYGLFQISNRNWCKSSEFPESENICDISCDKFLDDELADDIVCAKKIVAIKGIDYWKAHKPMC 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 36/112 (32%)
LalbaNP_036726.1 Lys 20..137 CDD:395016 36/112 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347594
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.