DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and Lyz1

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_038618.1 Gene:Lyz1 / 17110 MGIID:96902 Length:148 Species:Mus musculus


Alignment Length:141 Identity:52/141 - (36%)
Similarity:78/141 - (55%) Gaps:9/141 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVLNLLLLSQWETESKLLTRCQLAKELLRH--DFPRSY-LSNWVCLVEAESGRST-SKSMQLPNQ 73
            |.|.|||||. ..::|:..||:||:.|.|:  |..|.. |::||||.:.||..:| :.:....::
Mouse     5 LTLGLLLLSV-TAQAKVYNRCELARILKRNGMDGYRGVKLADWVCLAQHESNYNTRATNYNRGDR 68

  Fly    74 SVSYGLFQINSKNWCRKG---RRGGICNIKCEEFLNDEISDDSRCAMQIF-NRHGFQAWPGWMSK 134
            |..||:|||||:.||..|   |....|.|.|...|.|:|:...:||.::. :..|.:||..|.::
Mouse    69 STDYGIFQINSRYWCNDGKTPRSKNACGINCSALLQDDITAAIQCAKRVVRDPQGIRAWVAWRTQ 133

  Fly   135 CRGRTLPDVSR 145
            |:.|.|....|
Mouse   134 CQNRDLSQYIR 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 45/126 (36%)
Lyz1NP_038618.1 LYZ1 19..147 CDD:197612 45/126 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844227
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8674
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4912
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.890

Return to query results.
Submit another query.