DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and Lalba

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_034809.1 Gene:Lalba / 16770 MGIID:96742 Length:143 Species:Mus musculus


Alignment Length:129 Identity:43/129 - (33%)
Similarity:64/129 - (49%) Gaps:8/129 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LFLVLNLLLLSQWETESKLLTRCQLAKELLRHD-FPRSYLSNWVCLVEAESGRSTSKSMQLPNQS 74
            ||||..|.|.:...||   ||:|:::..:...| :....|..|.|::...||..| :::...|.|
Mouse     7 LFLVCILSLPAFQATE---LTKCKVSHAIKDIDGYQGISLLEWACVLFHTSGYDT-QAVVNDNGS 67

  Fly    75 VSYGLFQINSKNWCRKG---RRGGICNIKCEEFLNDEISDDSRCAMQIFNRHGFQAWPGWMSKC 135
            ..||||||:.:.||:..   ....||.|.|::.|:||:.||..||.:|....|...|..:...|
Mouse    68 TEYGLFQISDRFWCKSSEFPESENICGISCDKLLDDELDDDIACAKKILAIKGIDYWKAYKPMC 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 35/112 (31%)
LalbaNP_034809.1 Lys 21..138 CDD:333808 37/115 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844230
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.810

Return to query results.
Submit another query.