DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and SPACA3

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_776246.1 Gene:SPACA3 / 124912 HGNCID:16260 Length:215 Species:Homo sapiens


Alignment Length:146 Identity:52/146 - (35%)
Similarity:74/146 - (50%) Gaps:14/146 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALFLVLNLLLLSQWETESKLLTRCQLAKELLRHDFP----RSY-LSNWVCLVEAESGRSTSKSMQ 69
            ||..:|:.||.|   :|:||..||:||:.|  |||.    |.| |::||||....||.:.:....
Human    73 ALVCLLSCLLPS---SEAKLYGRCELARVL--HDFGLDGYRGYSLADWVCLAYFTSGFNAAALDY 132

  Fly    70 LPNQSVSYGLFQINSKNWCRK--GRRGGICNIKCEEFLNDEISDDSRCAMQIFNR-HGFQAWPGW 131
            ..:.|.:.|:|||||:.||..  .....:|.:.|.:.||..:.|...|||:|... .|...|..|
Human   133 EADGSTNNGIFQINSRRWCSNLTPNVPNVCRMYCSDLLNPNLKDTVICAMKITQEPQGLGYWEAW 197

  Fly   132 MSKCRGRTLPD-VSRC 146
            ...|:|:.|.: |..|
Human   198 RHHCQGKDLTEWVDGC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 44/126 (35%)
SPACA3NP_776246.1 LYZ_C 88..213 CDD:340383 44/126 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154001
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I5068
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8434
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4912
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.