DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and LOC100493330

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:XP_002935753.1 Gene:LOC100493330 / 100493330 -ID:- Length:140 Species:Xenopus tropicalis


Alignment Length:140 Identity:45/140 - (32%)
Similarity:65/140 - (46%) Gaps:11/140 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVLNLLLLSQWETESKLLTRCQLAKELLRHDFP--RSY-LSNWVCLVEAESGRSTSKSMQLPNQS 74
            :.|.:::.:.....|..|.||.:.:.:.|....  :.| |.::|||....|...||    |....
 Frog     3 ICLMIVVAAALAGNSWALDRCSVVRAIRRGGLAGIKGYSLGDFVCLAYHASRYDTS----LHRSP 63

  Fly    75 VSYGLFQINSKNWCRKGR---RGGICNIKCEEFLNDEISDDSRCAMQIF-NRHGFQAWPGWMSKC 135
            ..||:|||||..||..|:   |..:|.|.|...||..|:||.:|..:|. :.:|..||..|...|
 Frog    64 TEYGIFQINSYWWCDDGKTPGRKNVCRIPCRNLLNTNIADDVKCVKRIVSDPNGLAAWEPWKKYC 128

  Fly   136 RGRTLPDVSR 145
            ||:.|....|
 Frog   129 RGKNLSSYVR 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 43/125 (34%)
LOC100493330XP_002935753.1 LYZ_C 20..140 CDD:340383 43/123 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8219
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9321
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.