DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16799 and lyz

DIOPT Version :9

Sequence 1:NP_001286641.1 Gene:CG16799 / 37340 FlyBaseID:FBgn0034538 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_631919.1 Gene:lyz / 677744 ZFINID:ZDB-GENE-020515-2 Length:151 Species:Danio rerio


Alignment Length:146 Identity:46/146 - (31%)
Similarity:74/146 - (50%) Gaps:6/146 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VLILLQLGIEQVESKKYQRCELTRVLVEN--YNFDKTFISNWICLVEHESYLDTTKVTKKGNESK 89
            |:.|....:...|||...||::.::....  ..|:...|.|::|....||...|.:| :..:..|
Zfish     5 VVFLCLAWMSSCESKTLGRCDVYKIFKNEGLDGFEGFSIGNYVCTAYWESRFKTHRV-RSADTGK 68

  Fly    90 NYGLFQINSKDYCSEGRKGGQ--CNMKCEDFSNDDISDDIACARMIQEREGFKYWKGWDRFCRNP 152
            :||:|||||..:|.:|..||:  |.:.|.|..|||:...:.||::|.:.:|.|.|:.||.:| |.
Zfish    69 DYGIFQINSFKWCDDGTPGGKNLCKVACSDLLNDDLKASVGCAKLIVKMDGLKSWETWDSYC-NG 132

  Fly   153 QNLPNLRVACNLRSLS 168
            :.:......|..|..|
Zfish   133 RKMSRWVKGCEQRKQS 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16799NP_001286641.1 LYZ1 41..162 CDD:238066 39/124 (31%)
lyzNP_631919.1 LYZ1 19..140 CDD:238066 39/122 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589132
Domainoid 1 1.000 81 1.000 Domainoid score I8440
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5137
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - otm26024
orthoMCL 1 0.900 - - OOG6_113391
Panther 1 1.100 - - LDO PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.