DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16799 and LysP

DIOPT Version :9

Sequence 1:NP_001286641.1 Gene:CG16799 / 37340 FlyBaseID:FBgn0034538 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_476828.1 Gene:LysP / 38129 FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster


Alignment Length:146 Identity:45/146 - (30%)
Similarity:74/146 - (50%) Gaps:13/146 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MKTFCLWIVPVLILLQLGIEQVESKKYQRCELTRVLVENYNFDKTFISNWICLVEHESYLDTTKV 81
            ||.|.     |:..|.|.....:::...||.|.|.: ......:..::.|.|:.:|||...|..|
  Fly     1 MKAFL-----VICALTLTAVATQARTMDRCSLAREM-SKLGVPRDQLAKWTCIAQHESSFRTGVV 59

  Fly    82 -TKKGNESKNYGLFQINSKDYC--SEGR-KGGQCNMKCEDFSNDDISDDIACARMIQEREGFKYW 142
             ....|.|.:||:||||:|.:|  ::|| ...:|.:.|.....|||::.:.|||.||.::|:..|
  Fly    60 GPANSNGSNDYGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKIQRQQGWTAW 124

  Fly   143 KGWDRFCRNPQNLPNL 158
            ..| ::|..  :||::
  Fly   125 STW-KYCSG--SLPSI 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16799NP_001286641.1 LYZ1 41..162 CDD:238066 39/122 (32%)
LysPNP_476828.1 LYZ1 20..141 CDD:197612 39/122 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458906
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4912
SonicParanoid 1 1.000 - - X173
76.880

Return to query results.
Submit another query.