DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16799 and LysD

DIOPT Version :9

Sequence 1:NP_001286641.1 Gene:CG16799 / 37340 FlyBaseID:FBgn0034538 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_476823.1 Gene:LysD / 38127 FlyBaseID:FBgn0004427 Length:140 Species:Drosophila melanogaster


Alignment Length:137 Identity:41/137 - (29%)
Similarity:63/137 - (45%) Gaps:12/137 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MKTFCLWIVPVLILLQLGIEQVESKKYQRCELTRVLVENYNFDKTFISNWICLVEHESYLDTTKV 81
            ||.|.     ||:.|....... .:...||.|.|.: .|....:..::.|.|:.||||...|..|
  Fly     1 MKAFI-----VLVALACAAPAF-GRTMDRCSLAREM-SNLGVPRDQLARWACIAEHESSYRTGVV 58

  Fly    82 TKKG-NESKNYGLFQINSKDYCS--EGR-KGGQCNMKCEDFSNDDISDDIACARMIQEREGFKYW 142
            ..:. |.|.:||:||||...:|:  .|| ...:|.:.|.....|||:..:.||:.:..::|:..|
  Fly    59 GPENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQQGWSAW 123

  Fly   143 KGWDRFC 149
            ..| .:|
  Fly   124 STW-HYC 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16799NP_001286641.1 LYZ1 41..162 CDD:238066 35/113 (31%)
LysDNP_476823.1 LYZ_C_invert 19..139 CDD:381618 35/113 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458894
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
65.850

Return to query results.
Submit another query.