DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16799 and Lyzl1

DIOPT Version :9

Sequence 1:NP_001286641.1 Gene:CG16799 / 37340 FlyBaseID:FBgn0034538 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001102352.1 Gene:Lyzl1 / 364745 RGDID:1559869 Length:148 Species:Rattus norvegicus


Alignment Length:128 Identity:46/128 - (35%)
Similarity:78/128 - (60%) Gaps:6/128 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ILLQLGIEQVESKKYQRCELTRVLVEN--YNFDKTFISNWICLVEHESYLDTTKVTKKGNESKNY 91
            :::.||| ..|||.|.||:|.:|.|:.  .|:....:.||:|:..:||:.:|:..|...:.|.:|
  Rat     9 LIMSLGI-VAESKVYTRCKLAKVFVKAGLDNYGGFTLGNWLCMAYYESHYNTSAETVLEDGSTDY 72

  Fly    92 GLFQINSKDYCSEGRK--GGQCNMKCEDFSNDDISDDIACA-RMIQEREGFKYWKGWDRFCRN 151
            |:|||||..:|..|:|  ...|::.|...:.||::|.|.|| ::::|.:|..||:||.:.|.:
  Rat    73 GIFQINSFTWCRNGKKHQKNHCHVACSALTTDDLTDAILCAKKIVKETQGMNYWQGWKKNCES 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16799NP_001286641.1 LYZ1 41..162 CDD:238066 41/116 (35%)
Lyzl1NP_001102352.1 LYZ1 20..143 CDD:238066 41/116 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347598
Domainoid 1 1.000 89 1.000 Domainoid score I7645
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I4956
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8909
orthoMCL 1 0.900 - - OOG6_113391
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.