DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16799 and RGD1306474

DIOPT Version :10

Sequence 1:NP_611504.2 Gene:CG16799 / 37340 FlyBaseID:FBgn0034538 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_063119867.1 Gene:RGD1306474 / 362881 RGDID:1306474 Length:168 Species:Rattus norvegicus


Alignment Length:162 Identity:50/162 - (30%)
Similarity:79/162 - (48%) Gaps:21/162 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VPVLI---LLQLGIEQVESKKYQRCELTRVLVENY---NFDKTFISNWICLVEHESYLDTTKVTK 83
            :|.|:   ||.|.| .|:.|...||.|.|.| :.:   .|....::|||||.:..|..| ||..|
  Rat     4 LPTLLTLGLLLLSI-TVQGKVLNRCLLARTL-QRFGLGGFKGISLANWICLAKSVSGYD-TKAIK 65

  Fly    84 KGNE--SKNYGLFQINSKDYCSEGRKGGQ---CNMKCEDFSNDDISDDIACA-RMIQEREGFKYW 142
            ..:|  |.|||:|||:|:.:|::.:..|.   |.:.|:....::|...:.|| |::::..|...|
  Rat    66 YNHEDRSTNYGIFQISSRYWCNDSKTPGSKNFCRVSCKALLKNNIKASVTCAKRIVKDPRGITTW 130

  Fly   143 KGWDRFCRNPQNLPNLRVACNLRSLSPVRSPR 174
            .   .|....:|.....:   :||.:|...||
  Rat   131 Y---VFIVKEENCAGAGI---VRSFNPALWPR 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16799NP_611504.2 LYZ_C_invert 41..158 CDD:381618 38/125 (30%)
RGD1306474XP_063119867.1 None

Return to query results.
Submit another query.