DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16799 and Spaca5

DIOPT Version :9

Sequence 1:NP_001286641.1 Gene:CG16799 / 37340 FlyBaseID:FBgn0034538 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001101528.1 Gene:Spaca5 / 314431 RGDID:1584964 Length:160 Species:Rattus norvegicus


Alignment Length:135 Identity:51/135 - (37%)
Similarity:73/135 - (54%) Gaps:7/135 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FCLWIVPVLILLQLGIEQVESKKYQRCELTRVLVE-NYNFDKTF-ISNWICLVEHESYLDTTKVT 82
            ||..:|.:|..|.|.  .|::|.|:||||.|.|.: ..|..|.: :.:|:|:..:||..||:.|.
  Rat     3 FCSTVVVILATLLLA--TVDAKIYERCELARKLEKAGLNGFKGYTVGDWLCVAHYESGFDTSFVD 65

  Fly    83 KKGNESKNYGLFQINSKDYCSEGRKGGQ--CNMKCEDFSNDDISDDIACA-RMIQEREGFKYWKG 144
            ...:.|..||:||:||..:|:.|....|  |:|.|.|..|..|.|||.|| |::...:..|.|..
  Rat    66 HNPDGSSEYGIFQLNSAWWCNNGITPTQNLCHMDCNDLLNRHILDDIMCAKRVVSSHKSMKAWDS 130

  Fly   145 WDRFC 149
            |.|.|
  Rat   131 WTRHC 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16799NP_001286641.1 LYZ1 41..162 CDD:238066 44/114 (39%)
Spaca5NP_001101528.1 LYZ_C 22..147 CDD:340383 44/114 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347604
Domainoid 1 1.000 89 1.000 Domainoid score I7645
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I4956
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8909
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.890

Return to query results.
Submit another query.