DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16799 and Spaca5

DIOPT Version :9

Sequence 1:NP_001286641.1 Gene:CG16799 / 37340 FlyBaseID:FBgn0034538 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001078862.1 Gene:Spaca5 / 278203 MGIID:2685564 Length:160 Species:Mus musculus


Alignment Length:146 Identity:50/146 - (34%)
Similarity:76/146 - (52%) Gaps:6/146 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VPVLILLQLGIEQVESKKYQRCELTRVLVEN--YNFDKTFISNWICLVEHESYLDTTKVTKKGNE 87
            :.|:||..|.|.::::|.|:||||.:.|.|.  ..|....:.:|:|:..:||..||:.|....:.
Mouse     6 IVVVILAVLLIAKLDAKIYERCELAKKLEEAGLDGFKGYTVGDWLCVAHYESGFDTSFVDHNPDG 70

  Fly    88 SKNYGLFQINSKDYCSEGRKGGQ--CNMKCEDFSNDDISDDIACA-RMIQEREGFKYWKGWDRFC 149
            |..||:||:||..:|:.|....|  ||:.|.|..|..|.|||.|| |:....:..|.|..|.:.|
Mouse    71 SSEYGIFQLNSAWWCNNGITPTQNLCNIDCNDLLNRHILDDIICAKRVASSHKSMKAWDSWTQHC 135

  Fly   150 RNPQNLPNLRVACNLR 165
            .. .:|......|::|
Mouse   136 AG-HDLSEWLKGCSVR 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16799NP_001286641.1 LYZ1 41..162 CDD:238066 43/125 (34%)
Spaca5NP_001078862.1 LYZ1 22..145 CDD:238066 43/123 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844240
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8674
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4912
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.