DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16799 and Lyz2

DIOPT Version :9

Sequence 1:NP_001286641.1 Gene:CG16799 / 37340 FlyBaseID:FBgn0034538 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_038934368.1 Gene:Lyz2 / 25211 RGDID:3026 Length:192 Species:Rattus norvegicus


Alignment Length:177 Identity:47/177 - (26%)
Similarity:75/177 - (42%) Gaps:55/177 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LLQLGI----EQVESKKYQRCELTRVLVEN--YNFDKTFISNWICLVEHESYLDT-TKVTKKGNE 87
            ||.||.    ..|::|.|:|||..|.|..|  ..:....:::|:||.:|||..:| .:....|::
  Rat     4 LLVLGFLLLSASVQAKTYERCEFARTLKRNGMSGYYGVSLADWVCLAQHESNYNTQARNYNPGDQ 68

  Fly    88 SKNYGLFQINSKDYCSEG---RKGGQCNMKCE--------------------------------- 116
            |.:||:|||||:.:|::|   |....|.:.|.                                 
  Rat    69 STDYGIFQINSRYWCNDGKTPRAKNACGIPCSAVVTEKSSKHQQRRDILSLGTASIHLSGSLWET 133

  Fly   117 -----------DFSNDDISDDIACA-RMIQEREGFKYWKGWDRFCRN 151
                       ....|||:..|.|| |::::.:|.:.|..|.|.|:|
  Rat   134 LLRNVNPAVHTSLLQDDITQAIQCAKRVVRDPQGIRAWVAWQRHCKN 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16799NP_001286641.1 LYZ1 41..162 CDD:238066 42/162 (26%)
Lyz2XP_038934368.1 LYZ1 19..191 CDD:197612 42/162 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347592
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8909
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.