DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16799 and Lalba

DIOPT Version :9

Sequence 1:NP_001286641.1 Gene:CG16799 / 37340 FlyBaseID:FBgn0034538 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_036726.1 Gene:Lalba / 24528 RGDID:2987 Length:159 Species:Rattus norvegicus


Alignment Length:160 Identity:45/160 - (28%)
Similarity:77/160 - (48%) Gaps:20/160 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VPVLILLQLGIEQVESKKYQRCELTRVLVENYNFDKTFISNWICLVEHESYLDTTKVTKKGNESK 89
            || |.|..:.:...::.::.:||::..:.:...:....:..|.|::.|.|..|:..:. |.|.|.
  Rat     5 VP-LFLACISLPAFQATEFTKCEVSHAIEDMDGYQGISLLEWTCVLFHTSGYDSQAIV-KNNGST 67

  Fly    90 NYGLFQINSKDYCSEG---RKGGQCNMKCEDFSNDDISDDIACARMIQEREGFKYWKG------- 144
            .||||||:::::|...   .....|::.|:.|.:|:::|||.||:.|...:|..|||.       
  Rat    68 EYGLFQISNRNWCKSSEFPESENICDISCDKFLDDELADDIVCAKKIVAIKGIDYWKAHKPMCSE 132

  Fly   145 ----WDRFCRNPQNLPNLRVACNLRSLSPV 170
                |.  |..| ..|.|.|.. |.|.:||
  Rat   133 KLEQWR--CEKP-GAPALVVPA-LNSETPV 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16799NP_001286641.1 LYZ1 41..162 CDD:238066 37/134 (28%)
LalbaNP_036726.1 Lys 20..137 CDD:395016 31/117 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347595
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.