DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16799 and Lyz2

DIOPT Version :9

Sequence 1:NP_001286641.1 Gene:CG16799 / 37340 FlyBaseID:FBgn0034538 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_059068.1 Gene:Lyz2 / 17105 MGIID:96897 Length:148 Species:Mus musculus


Alignment Length:146 Identity:48/146 - (32%)
Similarity:77/146 - (52%) Gaps:21/146 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MKTFCLWIVPVLILLQLGI----EQVESKKYQRCELTRVLVEN--YNFDKTFISNWICLVEHESY 75
            |||          ||.||:    ...::|.|:|||..|.|..|  ..:....:::|:||.:|||.
Mouse     1 MKT----------LLTLGLLLLSVTAQAKVYERCEFARTLKRNGMAGYYGVSLADWVCLAQHESN 55

  Fly    76 LDTTKVT-KKGNESKNYGLFQINSKDYCSEG---RKGGQCNMKCEDFSNDDISDDIACA-RMIQE 135
            .:|.... .:|::|.:||:|||||:.:|::|   |....|.:.|.....|||:..|.|| |::::
Mouse    56 YNTRATNYNRGDQSTDYGIFQINSRYWCNDGKTPRAVNACGINCSALLQDDITAAIQCAKRVVRD 120

  Fly   136 REGFKYWKGWDRFCRN 151
            .:|.:.|..|...|:|
Mouse   121 PQGIRAWVAWRAHCQN 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16799NP_001286641.1 LYZ1 41..162 CDD:238066 41/118 (35%)
Lyz2NP_059068.1 LYZ1 19..147 CDD:197612 41/118 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844225
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8674
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11407
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4912
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.