DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16799 and LYZL2

DIOPT Version :9

Sequence 1:NP_001286641.1 Gene:CG16799 / 37340 FlyBaseID:FBgn0034538 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_011517608.1 Gene:LYZL2 / 119180 HGNCID:29613 Length:181 Species:Homo sapiens


Alignment Length:111 Identity:36/111 - (32%)
Similarity:57/111 - (51%) Gaps:15/111 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RDLMNMKTFCLWIVPVLILLQLGIEQVESKKYQRCELTRVL----VENY-NFDKTFISNWICLVE 71
            |..:.||.     ..:|.|:...:...|||.|.||:|.::.    ::|| .|.   :.||||:..
Human    42 RQALRMKA-----AGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFS---LGNWICMAY 98

  Fly    72 HESYLDTTKVTKKGNESKNYGLFQINSKDYCSEG--RKGGQCNMKC 115
            :||..:||..|...:.|.:||:|||||..:|..|  ::...|::.|
Human    99 YESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVAC 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16799NP_001286641.1 LYZ1 41..162 CDD:238066 29/82 (35%)
LYZL2XP_011517608.1 lysozyme_like 66..>145 CDD:294153 29/82 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153998
Domainoid 1 1.000 91 1.000 Domainoid score I7672
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I5068
Isobase 1 0.950 - 0 Normalized mean entropy S6956
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8434
orthoMCL 1 0.900 - - OOG6_113391
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.850

Return to query results.
Submit another query.