DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16799 and lyz

DIOPT Version :9

Sequence 1:NP_001286641.1 Gene:CG16799 / 37340 FlyBaseID:FBgn0034538 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_002938553.2 Gene:lyz / 100492798 XenbaseID:XB-GENE-488433 Length:153 Species:Xenopus tropicalis


Alignment Length:122 Identity:38/122 - (31%)
Similarity:67/122 - (54%) Gaps:13/122 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ESKKYQRCELTRVL----VENYNFDKTFISNWICLVEHES--YLDTTKVTKKGNESKNYGLFQIN 97
            :.|.::||||..::    ::.|.  ...:.||:|....||  |.|.|.. .:|:.|.:||:.|||
 Frog    18 DGKLFERCELAGIMKKMGLDGYR--GYSLPNWVCTAFFESSFYTDRTNF-NRGDNSTDYGILQIN 79

  Fly    98 SKDYCSEGRKGGQ---CNMKCEDFSNDDISDDIACA-RMIQEREGFKYWKGWDRFCR 150
            |:.:|::.:..|.   ||:.|....:|||:..:.|| |::::.:|.:.|.||...|:
 Frog    80 SRWWCNDNKTPGSHNACNINCRALLSDDITQSVICAKRVVRDPQGMEAWVGWRNHCK 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16799NP_001286641.1 LYZ1 41..162 CDD:238066 38/120 (32%)
lyzXP_002938553.2 LYZ_C 20..147 CDD:340383 38/120 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm9321
Panther 1 1.100 - - LDO PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.