DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11110 and Immp2l

DIOPT Version :9

Sequence 1:NP_611501.1 Gene:CG11110 / 37337 FlyBaseID:FBgn0034535 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_444352.2 Gene:Immp2l / 93757 MGIID:2135611 Length:175 Species:Mus musculus


Alignment Length:163 Identity:93/163 - (57%)
Similarity:120/163 - (73%) Gaps:1/163 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FRFFGKSLLYALPLGVTFLDCVGYVARVDGISMQPALNPVPDE-KDYVFLLRWGTHNSQVERGDI 66
            |:.|.|....|:|:.|||||.|..||||:|.||||:|||...: .|.|.|..|...|.:|:||||
Mouse    12 FKAFCKGFFVAVPVAVTFLDRVACVARVEGSSMQPSLNPGGSQSSDVVLLNHWKVRNFEVQRGDI 76

  Fly    67 ISLISPKDPAQKIIKRVVGLQGDVVSTLGYKHEIVRVPEGHCWVEGDHTGHSMDSNTFGPVALGL 131
            :||:|||:|.|||||||:.|:||:|.|:|:|:.:|:||.||.||||||.|||.|||:||||:|||
Mouse    77 VSLVSPKNPEQKIIKRVIALEGDIVRTIGHKNRLVKVPRGHMWVEGDHHGHSFDSNSFGPVSLGL 141

  Fly   132 MSARAVAIVWPPERWRILENELPRRRRPIQASK 164
            :.|.|..|:||||||:.||:.||..|.|:|..:
Mouse   142 LHAHATHILWPPERWQRLESVLPPERCPLQTGE 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11110NP_611501.1 sigpep_I_bact 27..142 CDD:274044 69/115 (60%)
S26_SPase_I 27..136 CDD:119398 67/109 (61%)
Immp2lNP_444352.2 sigpep_I_bact 33..152 CDD:274044 70/118 (59%)
S26_SPase_I 36..146 CDD:119398 67/109 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842284
Domainoid 1 1.000 100 1.000 Domainoid score I7024
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6607
Inparanoid 1 1.050 197 1.000 Inparanoid score I3797
Isobase 1 0.950 - 0 Normalized mean entropy S1031
OMA 1 1.010 - - QHG52912
OrthoDB 1 1.010 - - D1211147at2759
OrthoFinder 1 1.000 - - FOG0000835
OrthoInspector 1 1.000 - - oto91921
orthoMCL 1 0.900 - - OOG6_103471
Panther 1 1.100 - - LDO PTHR46041
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R608
SonicParanoid 1 1.000 - - X3411
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1716.750

Return to query results.
Submit another query.