DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11110 and IMP1

DIOPT Version :9

Sequence 1:NP_611501.1 Gene:CG11110 / 37337 FlyBaseID:FBgn0034535 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_013870.1 Gene:IMP1 / 855182 SGDID:S000004758 Length:190 Species:Saccharomyces cerevisiae


Alignment Length:152 Identity:50/152 - (32%)
Similarity:77/152 - (50%) Gaps:23/152 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FGKSLLYALPLGVTFLDCVGYVA----RVDGISMQPALNPVPDEKDYVFLLRWGTHNSQVERGDI 66
            :.|:..||: ..:.||..:...|    ...|.||.|.|:..   .|||.:|:...:...::.||.
Yeast     9 WSKTFSYAI-RSLCFLHIIHMYAYEFTETRGESMLPTLSAT---NDYVHVLKNFQNGRGIKMGDC 69

  Fly    67 ISLISPKDPAQKIIKRVVGLQGDVV----STL-GYKHEI----------VRVPEGHCWVEGDHTG 116
            |..:.|.||..:|.|||.|:.||:|    ||: .|..::          ::|||||.||.||:..
Yeast    70 IVALKPTDPNHRICKRVTGMPGDLVLVDPSTIVNYVGDVLVDEERFGTYIKVPEGHVWVTGDNLS 134

  Fly   117 HSMDSNTFGPVALGLMSARAVA 138
            ||:||.|:..:.:||:..:.||
Yeast   135 HSLDSRTYNALPMGLIMGKIVA 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11110NP_611501.1 sigpep_I_bact 27..142 CDD:274044 45/131 (34%)
S26_SPase_I 27..136 CDD:119398 43/127 (34%)
IMP1NP_013870.1 sigpep_I_bact 38..155 CDD:274044 42/119 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000835
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.