DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11110 and SEC11

DIOPT Version :9

Sequence 1:NP_611501.1 Gene:CG11110 / 37337 FlyBaseID:FBgn0034535 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_012288.1 Gene:SEC11 / 854840 SGDID:S000001461 Length:167 Species:Saccharomyces cerevisiae


Alignment Length:50 Identity:17/50 - (34%)
Similarity:22/50 - (44%) Gaps:4/50 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DYVFLLRWGTHNSQVERGDIISLISPKDPAQKIIKRVVGLQGDVVSTLGY 96
            |..|||..|.:|:    |:.|||.:.|.......|.:||........|||
Yeast    94 DKQFLLTKGDNNA----GNDISLYANKKIYLNKSKEIVGTVKGYFPQLGY 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11110NP_611501.1 sigpep_I_bact 27..142 CDD:274044 16/49 (33%)
S26_SPase_I 27..136 CDD:119398 16/49 (33%)
SEC11NP_012288.1 Peptidase_S24_S26 26..146 CDD:415851 16/49 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.