powered by:
Protein Alignment CG11110 and SEC11
DIOPT Version :9
Sequence 1: | NP_611501.1 |
Gene: | CG11110 / 37337 |
FlyBaseID: | FBgn0034535 |
Length: | 171 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_012288.1 |
Gene: | SEC11 / 854840 |
SGDID: | S000001461 |
Length: | 167 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 50 |
Identity: | 17/50 - (34%) |
Similarity: | 22/50 - (44%) |
Gaps: | 4/50 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 DYVFLLRWGTHNSQVERGDIISLISPKDPAQKIIKRVVGLQGDVVSTLGY 96
|..|||..|.:|: |:.|||.:.|.......|.:||........|||
Yeast 94 DKQFLLTKGDNNA----GNDISLYANKKIYLNKSKEIVGTVKGYFPQLGY 139
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0681 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.