DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11110 and AT1G53530

DIOPT Version :9

Sequence 1:NP_611501.1 Gene:CG11110 / 37337 FlyBaseID:FBgn0034535 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_175758.2 Gene:AT1G53530 / 841788 AraportID:AT1G53530 Length:168 Species:Arabidopsis thaliana


Alignment Length:121 Identity:46/121 - (38%)
Similarity:68/121 - (56%) Gaps:10/121 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VDGISMQPALNPVPDEKDYVFLLRWGTHN-SQVERGDIISLISPKDPAQKIIKRVVGLQGDVVS- 92
            |.|.||.|.||...|    |.|....:|. .::..||::.:.||:||.:.:.||::||:||.:: 
plant    46 VHGPSMLPTLNLTGD----VILAEHLSHRFGKIGLGDVVLVRSPRDPKRMVTKRILGLEGDRLTF 106

  Fly    93 ----TLGYKHEIVRVPEGHCWVEGDHTGHSMDSNTFGPVALGLMSARAVAIVWPPE 144
                .:|.....|.||:||.|::||:...|.||..||||...|:..:|:..|||||
plant   107 SADPLVGDASVSVLVPKGHVWIQGDNLYASTDSRHFGPVPYSLIEGKALLRVWPPE 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11110NP_611501.1 sigpep_I_bact 27..142 CDD:274044 42/117 (36%)
S26_SPase_I 27..136 CDD:119398 40/111 (36%)
AT1G53530NP_175758.2 sigpep_I_bact 46..160 CDD:274044 42/117 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1211147at2759
OrthoFinder 1 1.000 - - FOG0000835
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.