DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11110 and AT1G29960

DIOPT Version :9

Sequence 1:NP_611501.1 Gene:CG11110 / 37337 FlyBaseID:FBgn0034535 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_174289.2 Gene:AT1G29960 / 839874 AraportID:AT1G29960 Length:169 Species:Arabidopsis thaliana


Alignment Length:124 Identity:44/124 - (35%)
Similarity:71/124 - (57%) Gaps:8/124 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VGYVARVDGISMQPALNPVPDEKDYVFLLRWGTHNSQVERGDIISLISPKDPAQKIIKRVVGLQG 88
            :|::|...|.||.|.|:|   ..:.:...|......:..||||:.:.||::|.:..||||:|::|
plant    37 LGFMAYAYGPSMTPTLHP---SGNVLLAERISKRYQKPSRGDIVVIRSPENPNKTPIKRVIGIEG 98

  Fly    89 DVVSTL-----GYKHEIVRVPEGHCWVEGDHTGHSMDSNTFGPVALGLMSARAVAIVWP 142
            |.:|.:     ..:.:.:.||:||.:|:||:|.:|.||..||.|..||:..|.:..|||
plant    99 DCISFVIDSRKSDESQTIVVPKGHVFVQGDYTHNSRDSRNFGTVPYGLIQGRVLWRVWP 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11110NP_611501.1 sigpep_I_bact 27..142 CDD:274044 41/119 (34%)
S26_SPase_I 27..136 CDD:119398 39/113 (35%)
AT1G29960NP_174289.2 sigpep_I_bact 45..158 CDD:274044 42/116 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1211147at2759
OrthoFinder 1 1.000 - - FOG0000835
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.