DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11110 and PLSP1

DIOPT Version :9

Sequence 1:NP_611501.1 Gene:CG11110 / 37337 FlyBaseID:FBgn0034535 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_189102.3 Gene:PLSP1 / 822055 AraportID:AT3G24590 Length:310 Species:Arabidopsis thaliana


Alignment Length:176 Identity:46/176 - (26%)
Similarity:67/176 - (38%) Gaps:56/176 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFRFFGKSLLYALPLGVTFLDCVGYVARVDGISMQPALNP----VPDEKDYVFLLRWGTHNSQV 61
            :|||:|.....|                 :..:||.|..:.    |.::..|.|  |....|   
plant   145 LAFRYFIAEPRY-----------------IPSLSMYPTFDVGDRLVAEKVSYYF--RKPCAN--- 187

  Fly    62 ERGDIISLISPK-------DPAQKIIKRVVGLQGDVVST--------------------LGYKHE 99
               ||:...||.       ..|...|||:|..:||:|..                    .||:..
plant   188 ---DIVIFKSPPVLQEVGYTDADVFIKRIVAKEGDLVEVHNGKLMVNGVARNEKFILEPPGYEMT 249

  Fly   100 IVRVPEGHCWVEGDHTGHSMDSNTFGPVALGLMSARAVAIVWPPER 145
            .:||||...:|.||:..:|.||:.:||:.|..:..|:|...|||.|
plant   250 PIRVPENSVFVMGDNRNNSYDSHVWGPLPLKNIIGRSVFRYWPPNR 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11110NP_611501.1 sigpep_I_bact 27..142 CDD:274044 37/145 (26%)
S26_SPase_I 27..136 CDD:119398 35/139 (25%)
PLSP1NP_189102.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1211147at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.