DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11110 and TPP

DIOPT Version :9

Sequence 1:NP_611501.1 Gene:CG11110 / 37337 FlyBaseID:FBgn0034535 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_180603.2 Gene:TPP / 817595 AraportID:AT2G30440 Length:340 Species:Arabidopsis thaliana


Alignment Length:168 Identity:39/168 - (23%)
Similarity:67/168 - (39%) Gaps:34/168 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KSLLYALPLGVTFLDCVGYVARVDGISMQPALNPVPDEKDYVFLLRWGTHNSQVERGDIISLISP 72
            |:...|:.:.:.|...:.....:...||.|.|    |:.|.|...:......:.|..||:...:|
plant   158 KAAFTAVTVSILFRSALAEPKSIPSTSMYPTL----DKGDRVMAEKVSYFFRKPEVSDIVIFKAP 218

  Fly    73 K----------DPAQKIIKRVVGLQGD--------------------VVSTLGYKHEIVRVPEGH 107
            .          ......|||:|..:||                    |:..:.|:.|.:.||:|:
plant   219 PILLEYPEYGYSSNDVFIKRIVASEGDWVEVRDGKLFVNDIVQEEDFVLEPMSYEMEPMFVPKGY 283

  Fly   108 CWVEGDHTGHSMDSNTFGPVALGLMSARAVAIVWPPER 145
            .:|.||:...|.||:.:||:.:..:..|:|...|||.:
plant   284 VFVLGDNRNKSFDSHNWGPLPIENIVGRSVFRYWPPSK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11110NP_611501.1 sigpep_I_bact 27..142 CDD:274044 33/144 (23%)
S26_SPase_I 27..136 CDD:119398 31/138 (22%)
TPPNP_180603.2 Peptidase_S26 157..317 CDD:402227 36/162 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1211147at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.