DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11110 and immp1l

DIOPT Version :9

Sequence 1:NP_611501.1 Gene:CG11110 / 37337 FlyBaseID:FBgn0034535 Length:171 Species:Drosophila melanogaster
Sequence 2:XP_001335263.1 Gene:immp1l / 795154 ZFINID:ZDB-GENE-070522-4 Length:189 Species:Danio rerio


Alignment Length:152 Identity:51/152 - (33%)
Similarity:76/152 - (50%) Gaps:27/152 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AFRFFGKSLLYALPLGVTFLDCVGYVARVDGISMQPALNPVPDEKDYVFLLRWGTHNSQVERGDI 66
            ||.:.|:           |:.|.|           |::.|.....|.||..|...|..::::|||
Zfish    51 AFEYVGE-----------FVSCSG-----------PSMEPTITNHDVVFSERISRHLYRIQKGDI 93

  Fly    67 ISLISPKDPAQKIIKRVVGLQGDVVSTLGYKHEIVR----VPEGHCWVEGDHTGHSMDSNTFGPV 127
            |...||.:|...|.|||:||:||.|.|.| ..:|.:    ||.||.|:|||:..:|.||.::||:
Zfish    94 IIAKSPSNPKMNICKRVIGLEGDKVCTSG-PSDIFKTHTYVPRGHVWLEGDNLRNSTDSRSYGPI 157

  Fly   128 ALGLMSARAVAIVWPPERWRIL 149
            ...|:..|....:|||:.:.:|
Zfish   158 PYALIRGRVCLKLWPPQSFGVL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11110NP_611501.1 sigpep_I_bact 27..142 CDD:274044 41/118 (35%)
S26_SPase_I 27..136 CDD:119398 40/112 (36%)
immp1lXP_001335263.1 sigpep_I_bact 54..172 CDD:274044 45/140 (32%)
S26_SPase_I 57..166 CDD:119398 43/131 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1211147at2759
OrthoFinder 1 1.000 - - FOG0000835
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.