DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11110 and Immp1l

DIOPT Version :9

Sequence 1:NP_611501.1 Gene:CG11110 / 37337 FlyBaseID:FBgn0034535 Length:171 Species:Drosophila melanogaster
Sequence 2:XP_001076990.3 Gene:Immp1l / 691145 RGDID:1587441 Length:166 Species:Rattus norvegicus


Alignment Length:150 Identity:53/150 - (35%)
Similarity:71/150 - (47%) Gaps:20/150 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AFRFFGKSLLYALPLGVTFLDCVGYVARVDGISMQPALNPVPDEKDYVFLLRWGTHNSQVERGDI 66
            |||..|.::.|.......| :.||.|....|.||:|.:    ...|.||......|...::||||
  Rat     9 AFRLAGYTIQYGCIAHCAF-EYVGGVVMCSGPSMEPTI----QNSDIVFAENLSRHFYGIQRGDI 68

  Fly    67 ISLISPKDPAQKIIKRVVGLQG---------DVVSTLGYKHEIVRVPEGHCWVEGDHTGHSMDSN 122
            :...||.||...|.|||:||:|         |:..:..|      ||.||.|:|||:..:|.||.
  Rat    69 VIAKSPSDPKSSICKRVIGLEGDKILADNPPDIFKSRNY------VPTGHVWLEGDNLENSTDSR 127

  Fly   123 TFGPVALGLMSARAVAIVWP 142
            .:|||..||:..|....:||
  Rat   128 CYGPVPYGLIRGRIFFKIWP 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11110NP_611501.1 sigpep_I_bact 27..142 CDD:274044 43/123 (35%)
S26_SPase_I 27..136 CDD:119398 42/117 (36%)
Immp1lXP_001076990.3 sigpep_I_bact 29..149 CDD:274044 46/128 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1211147at2759
OrthoFinder 1 1.000 - - FOG0000835
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.