DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11110 and Immp1l

DIOPT Version :9

Sequence 1:NP_611501.1 Gene:CG11110 / 37337 FlyBaseID:FBgn0034535 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_082536.1 Gene:Immp1l / 66541 MGIID:1913791 Length:166 Species:Mus musculus


Alignment Length:146 Identity:53/146 - (36%)
Similarity:75/146 - (51%) Gaps:12/146 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AFRFFGKSLLYALPLGVTFLDCVGYVARVDGISMQPALNPVPDEKDYVFLLRWGTHNSQVERGDI 66
            |||..|.::.|.......| :.||.|....|.||:|.:    ...|.||......|...::||||
Mouse     9 AFRLAGYTIQYGCIAHCAF-EYVGGVVMCSGPSMEPTI----QNSDIVFAENLSRHFYGIQRGDI 68

  Fly    67 ISLISPKDPAQKIIKRVVGLQGD-VVSTLGYKHEIVR----VPEGHCWVEGDHTGHSMDSNTFGP 126
            :...||.||...|.|||:||:|| ::||  ...::.:    ||.||.|:|||:..:|.||..:||
Mouse    69 VIAKSPSDPKSNICKRVIGLEGDKILST--SPSDVFKSRSYVPTGHVWLEGDNLQNSTDSRYYGP 131

  Fly   127 VALGLMSARAVAIVWP 142
            :..||:..|....:||
Mouse   132 IPYGLIRGRIFFKIWP 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11110NP_611501.1 sigpep_I_bact 27..142 CDD:274044 43/119 (36%)
S26_SPase_I 27..136 CDD:119398 42/113 (37%)
Immp1lNP_082536.1 sigpep_I_bact 29..149 CDD:274044 47/125 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000835
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.