DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11110 and immp1l

DIOPT Version :9

Sequence 1:NP_611501.1 Gene:CG11110 / 37337 FlyBaseID:FBgn0034535 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001016589.1 Gene:immp1l / 549343 XenbaseID:XB-GENE-5806212 Length:167 Species:Xenopus tropicalis


Alignment Length:173 Identity:61/173 - (35%)
Similarity:83/173 - (47%) Gaps:28/173 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFRFFGKSLLYALPLGVTF---------LDCVGYVARVDGISMQPALNPVPDEKDYVFLL--RW 54
            |..|..||:|..   ||.|.         .:.:|.|....|.||:|.:      ::|..||  ..
 Frog     1 MIRRIVGKTLGL---LGYTIQYGCIAHCAFEYIGEVVICSGPSMEPTI------RNYDVLLCDNL 56

  Fly    55 GTHNSQVERGDIISLISPKDPAQKIIKRVVGLQGDVV-----STLGYKHEIVRVPEGHCWVEGDH 114
            ..|...:.:||||...||..|:..|.|||:||:||.|     |.|..:|  ..||:||.|:|||:
 Frog    57 SRHFFSIHKGDIIVAKSPDKPSVNICKRVIGLEGDKVCMSSPSALLKRH--TYVPKGHVWLEGDN 119

  Fly   115 TGHSMDSNTFGPVALGLMSARAVAIVWPPERWRILENELPRRR 157
            ..:|.||.::|||...|:..|....|||.|.:..|: |.|..|
 Frog   120 LDNSTDSRSYGPVPYALIRGRICLRVWPLESFGPLK-ESPNGR 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11110NP_611501.1 sigpep_I_bact 27..142 CDD:274044 45/121 (37%)
S26_SPase_I 27..136 CDD:119398 43/115 (37%)
immp1lNP_001016589.1 S26_SPase_I 32..141 CDD:119398 43/116 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1211147at2759
OrthoFinder 1 1.000 - - FOG0000835
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.