DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11110 and immp2l

DIOPT Version :9

Sequence 1:NP_611501.1 Gene:CG11110 / 37337 FlyBaseID:FBgn0034535 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001003755.1 Gene:immp2l / 445299 ZFINID:ZDB-GENE-040808-9 Length:183 Species:Danio rerio


Alignment Length:159 Identity:89/159 - (55%)
Similarity:115/159 - (72%) Gaps:1/159 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FRFFGKSLLYALPLGVTFLDCVGYVARVDGISMQPALNPVPDEK-DYVFLLRWGTHNSQVERGDI 66
            |:.|......|:|:.||.||.:.|||||:|.||||:|||..:.. |.|.|.||...|..|:||||
Zfish    11 FKAFVSGFFVAVPVTVTVLDRLAYVARVEGASMQPSLNPDGESSPDVVLLNRWSVRNYHVQRGDI 75

  Fly    67 ISLISPKDPAQKIIKRVVGLQGDVVSTLGYKHEIVRVPEGHCWVEGDHTGHSMDSNTFGPVALGL 131
            :|::|||:|.|||||||:|::||.:.|||||:..||||:||.|:||||.|||.|||.||||:|||
Zfish    76 VSVLSPKNPQQKIIKRVIGIEGDFIKTLGYKNRYVRVPDGHLWIEGDHHGHSFDSNAFGPVSLGL 140

  Fly   132 MSARAVAIVWPPERWRILENELPRRRRPI 160
            :..||..|:|||.||:.:|..:|..|||:
Zfish   141 VHGRASHIIWPPSRWQRIEPSVPPDRRPL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11110NP_611501.1 sigpep_I_bact 27..142 CDD:274044 70/115 (61%)
S26_SPase_I 27..136 CDD:119398 67/109 (61%)
immp2lNP_001003755.1 sigpep_I_bact 32..153 CDD:274044 73/120 (61%)
S26_SPase_I 35..145 CDD:119398 67/109 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..183 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586687
Domainoid 1 1.000 91 1.000 Domainoid score I7685
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6607
Inparanoid 1 1.050 193 1.000 Inparanoid score I3835
OMA 1 1.010 - - QHG52912
OrthoDB 1 1.010 - - D1211147at2759
OrthoFinder 1 1.000 - - FOG0000835
OrthoInspector 1 1.000 - - otm25119
orthoMCL 1 0.900 - - OOG6_103471
Panther 1 1.100 - - LDO PTHR46041
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3411
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.