DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11110 and CG9240

DIOPT Version :9

Sequence 1:NP_611501.1 Gene:CG11110 / 37337 FlyBaseID:FBgn0034535 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_573054.2 Gene:CG9240 / 32505 FlyBaseID:FBgn0030669 Length:166 Species:Drosophila melanogaster


Alignment Length:157 Identity:52/157 - (33%)
Similarity:74/157 - (47%) Gaps:24/157 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RFFGKSLLYALPLGVTFLDCVGYVARVDGISMQPALNPVPDEKDYVFLL-RWGTHNSQVERGDII 67
            |....::.||.....|| :.:|......|.||:|.|:     .|.|.|. |...|....:.|||:
  Fly     9 RLMRYTVAYAAITHCTF-EYIGDFVLCKGPSMEPTLH-----SDNVLLTERLSKHWRTYQPGDIV 67

  Fly    68 SLISPKDPAQKIIKRVVGLQGDVV---------------STLGYKHEIVR--VPEGHCWVEGDHT 115
            ..|||....|.|.||:|.:.||.|               |....|..:|:  ||.||.|:|||:.
  Fly    68 IAISPIKADQFICKRIVAVSGDQVLIQKPIPIEAEFSGNSDDKKKPVMVKDYVPRGHVWIEGDNK 132

  Fly   116 GHSMDSNTFGPVALGLMSARAVAIVWP 142
            |:|.||..:||:.:||:.:|.:..:||
  Fly   133 GNSSDSRYYGPIPVGLIRSRVLCRIWP 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11110NP_611501.1 sigpep_I_bact 27..142 CDD:274044 44/132 (33%)
S26_SPase_I 27..136 CDD:119398 43/126 (34%)
CG9240NP_573054.2 sigpep_I_bact 30..159 CDD:274044 44/133 (33%)
S26_SPase_I 31..153 CDD:119398 43/126 (34%)
Peptidase_S24_S26 <81..145 CDD:299172 23/63 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458100
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1211147at2759
OrthoFinder 1 1.000 - - FOG0000835
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.