DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11110 and SPBC2D10.07c

DIOPT Version :9

Sequence 1:NP_611501.1 Gene:CG11110 / 37337 FlyBaseID:FBgn0034535 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_596226.1 Gene:SPBC2D10.07c / 2540493 PomBaseID:SPBC2D10.07c Length:157 Species:Schizosaccharomyces pombe


Alignment Length:150 Identity:44/150 - (29%)
Similarity:73/150 - (48%) Gaps:21/150 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LYALPLGVTFL--------DCVGYVARVDGISMQPALNPVPDEKDYVFLLR-WGTHNSQVERGDI 66
            ::.:|:.|..:        :.:..|....|.||.|.||   ...::|.|.: .|........||:
pombe     4 MFRIPIAVVQIAAFVHQIHEYLFQVQMTSGPSMMPTLN---SGGEFVLLDKLHGRFARSCSVGDV 65

  Fly    67 ISLISPKDPAQKIIKRVVGLQGDVVSTLGY-----KHEIVRVPEGHCWVEGDHTGHSMDSNTFGP 126
            :....|.|..|.:.||::|:.||.:    |     .::.:.:|.||.|:.||:..||:||..:||
pombe    66 VVSAKPSDSKQHVCKRIIGMPGDTI----YVDPTSSNKKITIPLGHVWLAGDNIAHSLDSRNYGP 126

  Fly   127 VALGLMSARAVAIVWPPERW 146
            |.:||:.|:.:|.|||...|
pombe   127 VPMGLIKAKVIARVWPHPHW 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11110NP_611501.1 sigpep_I_bact 27..142 CDD:274044 39/120 (33%)
S26_SPase_I 27..136 CDD:119398 37/114 (32%)
SPBC2D10.07cNP_596226.1 sigpep_I_bact 24..142 CDD:274044 39/124 (31%)
S26_SPase_I 27..136 CDD:119398 37/115 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000835
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.