DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11110 and IMMP1L

DIOPT Version :9

Sequence 1:NP_611501.1 Gene:CG11110 / 37337 FlyBaseID:FBgn0034535 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001291203.1 Gene:IMMP1L / 196294 HGNCID:26317 Length:166 Species:Homo sapiens


Alignment Length:145 Identity:53/145 - (36%)
Similarity:72/145 - (49%) Gaps:12/145 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FRFFGKSLLYALPLGVTFLDCVGYVARVDGISMQPALNPVPDEKDYVFLLRWGTHNSQVERGDII 67
            ||..|.::.|.......| :.||.|....|.||:|.:    ...|.||......|...::||||:
Human    10 FRLVGYTIQYGCIAHCAF-EYVGGVVMCSGPSMEPTI----QNSDIVFAENLSRHFYGIQRGDIV 69

  Fly    68 SLISPKDPAQKIIKRVVGLQGDVVSTLG----YK-HEIVRVPEGHCWVEGDHTGHSMDSNTFGPV 127
            ...||.||...|.|||:||:||.:.|..    :| |..  ||.||.|:|||:..:|.||..:||:
Human    70 IAKSPSDPKSNICKRVIGLEGDKILTTSPSDFFKSHSY--VPMGHVWLEGDNLQNSTDSRCYGPI 132

  Fly   128 ALGLMSARAVAIVWP 142
            ..||:..|....:||
Human   133 PYGLIRGRIFFKIWP 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11110NP_611501.1 sigpep_I_bact 27..142 CDD:274044 44/119 (37%)
S26_SPase_I 27..136 CDD:119398 43/113 (38%)
IMMP1LNP_001291203.1 S26_SPase_I 33..141 CDD:119398 43/113 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1211147at2759
OrthoFinder 1 1.000 - - FOG0000835
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.