DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11110 and sec-11

DIOPT Version :9

Sequence 1:NP_611501.1 Gene:CG11110 / 37337 FlyBaseID:FBgn0034535 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_491092.1 Gene:sec-11 / 171876 WormBaseID:WBGene00021844 Length:183 Species:Caenorhabditis elegans


Alignment Length:91 Identity:17/91 - (18%)
Similarity:38/91 - (41%) Gaps:11/91 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FLDCVGYVARV-DGISMQPALNPVPDEKDYVFLLRWGTHNSQVERGDIISLISP-KDPAQK---I 79
            |..|:.:...| ..:.:...:..:......|.::..|:......|||::.|.:. :||.:.   .
 Worm    22 FYQCLNFAMVVSSALMIWKGMMVITGSDSPVVVVLSGSMEPAFYRGDLLLLTNDLEDPVRVGDIT 86

  Fly    80 IKRVVGLQGDVVSTLGYKHEIVRVPE 105
            :.:|.|.:..:|      |.:::|.|
 Worm    87 VFKVEGREIPIV------HRVIKVHE 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11110NP_611501.1 sigpep_I_bact 27..142 CDD:274044 15/84 (18%)
S26_SPase_I 27..136 CDD:119398 15/84 (18%)
sec-11NP_491092.1 Peptidase_S24_S26 41..178 CDD:299172 14/72 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.