DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11110 and Immp2l

DIOPT Version :9

Sequence 1:NP_611501.1 Gene:CG11110 / 37337 FlyBaseID:FBgn0034535 Length:171 Species:Drosophila melanogaster
Sequence 2:XP_038934060.1 Gene:Immp2l / 100359529 RGDID:2323665 Length:188 Species:Rattus norvegicus


Alignment Length:93 Identity:50/93 - (53%)
Similarity:65/93 - (69%) Gaps:1/93 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FRFFGKSLLYALPLGVTFLDCVGYVARVDGISMQPALNPVPDE-KDYVFLLRWGTHNSQVERGDI 66
            |:.|.|....|:|:.|||||.|..||||:|.||||:|||...: .|.|.|..|...|.:|:||||
  Rat    12 FKAFCKGFFVAVPVAVTFLDRVVCVARVEGSSMQPSLNPGGSQSSDVVLLNHWKVRNFEVQRGDI 76

  Fly    67 ISLISPKDPAQKIIKRVVGLQGDVVSTL 94
            :||:|||:|.|||||||:.|:||::..|
  Rat    77 VSLVSPKNPEQKIIKRVIALEGDIIRFL 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11110NP_611501.1 sigpep_I_bact 27..142 CDD:274044 39/69 (57%)
S26_SPase_I 27..136 CDD:119398 39/69 (57%)
Immp2lXP_038934060.1 S26_SPase_I 36..>99 CDD:119398 36/62 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6607
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1211147at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.