DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and Mafg

DIOPT Version :9

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:XP_006247975.1 Gene:Mafg / 64188 RGDID:619953 Length:219 Species:Rattus norvegicus


Alignment Length:97 Identity:51/97 - (52%)
Similarity:78/97 - (80%) Gaps:2/97 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ITDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKKSYE 91
            :||::||::|||:||:.|  |||::|||:::|||||||||||||||||:||:.||:|||.:|:..
  Rat    81 LTDEELVTMSVRELNQHL--RGLSKEEIIQLKQRRRTLKNRGYAASCRVKRVTQKEELEKQKAEL 143

  Fly    92 WTELEQMHEDNEQVRREVSNWKNKYKALLQFA 123
            ..|:|::..:|..::.|:...::||:||..||
  Rat   144 QQEVEKLASENASMKLELDALRSKYEALQNFA 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 35/68 (51%)
coiled coil 59..110 CDD:269865 28/50 (56%)
MafgXP_006247975.1 bZIP_Maf_small 103..172 CDD:269865 35/68 (51%)
coiled coil 103..172 CDD:269865 35/68 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337424
Domainoid 1 1.000 102 1.000 Domainoid score I6669
eggNOG 1 0.900 - - E1_KOG4196
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I4814
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 1 1.000 - - FOG0001412
OrthoInspector 1 1.000 - - otm45784
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10129
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1287
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.