DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and nrl

DIOPT Version :10

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:XP_012808720.1 Gene:nrl / 613052 XenbaseID:XB-GENE-6456353 Length:346 Species:Xenopus tropicalis


Alignment Length:105 Identity:49/105 - (46%)
Similarity:73/105 - (69%) Gaps:3/105 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QAPLSPCPIPDITDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQ 80
            |..|||.. ...:|:.||.:|||:|||  ::||.::||.:|:|||||||||||||.|||.||::|
 Frog   219 QHQLSPLS-ERFSDEQLVGMSVRELNR--QLRGFSKEEALRLKQRRRTLKNRGYAQSCRYKRVQQ 280

  Fly    81 KDELETKKSYEWTELEQMHEDNEQVRREVSNWKNKYKALL 120
            :..|||:|.....:|:|:.::..::.||...|:.:|:.||
 Frog   281 RHVLETEKCQLSRQLQQLQQEVARITRERDGWRARYEKLL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 32/68 (47%)
coiled coil 51..120 CDD:269865 32/68 (47%)
nrlXP_012808720.1 Maf_N 149..182 CDD:462456
bZIP_Maf_large 251..319 CDD:269866 32/67 (48%)
coiled coil 251..319 CDD:269866 32/67 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.