DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and maf

DIOPT Version :9

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001027476.1 Gene:maf / 613051 XenbaseID:XB-GENE-6053271 Length:346 Species:Xenopus tropicalis


Alignment Length:93 Identity:43/93 - (46%)
Similarity:72/93 - (77%) Gaps:2/93 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKKSYEW 92
            :|:.||::|||:|||  ::||:::||::|:||:||||||||||.|||.||::|:..||::|:...
 Frog   239 SDEQLVTMSVRELNR--QLRGVSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHVLESEKNQLL 301

  Fly    93 TELEQMHEDNEQVRREVSNWKNKYKALL 120
            .::|.:.::..::.||...:|.||:.||
 Frog   302 QQVEHLKQEISRLLRERDAYKEKYEKLL 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 30/68 (44%)
coiled coil 59..110 CDD:269865 23/50 (46%)
mafNP_001027476.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..85
Maf_N 87..119 CDD:285569
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..234
bZIP_Maf_large 260..328 CDD:269866 30/67 (45%)
coiled coil 260..328 CDD:269866 30/67 (45%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 265..290 18/24 (75%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 293..314 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5055
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.