DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and mafb

DIOPT Version :10

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001025694.1 Gene:mafb / 595086 XenbaseID:XB-GENE-6085859 Length:316 Species:Xenopus tropicalis


Alignment Length:92 Identity:44/92 - (47%)
Similarity:66/92 - (71%) Gaps:2/92 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKKSYEW 92
            :||.|||:|||:|||.|  ||..:::::|:||:||||||||||.|||.||::||..||.:|:...
 Frog   205 SDDQLVSMSVRELNRHL--RGFTKDDVIRLKQKRRTLKNRGYAQSCRFKRVQQKHHLENEKTQLI 267

  Fly    93 TELEQMHEDNEQVRREVSNWKNKYKAL 119
            .::||:..:..::.||...:|.|.:.|
 Frog   268 QQVEQLKLEVSRLARERDAYKIKCEKL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 30/69 (43%)
coiled coil 51..120 CDD:269865 30/69 (43%)
mafbNP_001025694.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..78
Maf_N 81..114 CDD:462456
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..204
bZIP_Maf_large 226..295 CDD:269866 30/69 (43%)
coiled coil 226..295 CDD:269866 30/69 (43%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 231..256 18/24 (75%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 259..280 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.