DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and nrl

DIOPT Version :9

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001035421.1 Gene:nrl / 554169 ZFINID:ZDB-GENE-050729-1 Length:412 Species:Danio rerio


Alignment Length:120 Identity:50/120 - (41%)
Similarity:80/120 - (66%) Gaps:8/120 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LSPCPIPD-ITDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKD 82
            ::.|.:.: .:|:.|||:|||:|||.|  ||::::|:||:||:||||||||||.|||.||::.:.
Zfish   289 VAQCGVEERFSDEQLVSLSVRELNRHL--RGVSKDEVVRLKQKRRTLKNRGYAQSCRYKRLQHRH 351

  Fly    83 ELETKKSYEWTELEQMHEDNEQVRREVSNWKNKYKALL-----QFAIQNEIPIPS 132
            .||::|.....:|||:..:..:|.||...:|.:|:.|:     |.:..|..|.|:
Zfish   352 ALESEKHILTQQLEQLQCELSRVLRERDTYKARYEKLISSSERQPSHPNTSPSPT 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 31/68 (46%)
coiled coil 59..110 CDD:269865 25/50 (50%)
nrlNP_001035421.1 Maf_N 136..191 CDD:285569
bZIP_Maf_large 320..389 CDD:269866 31/68 (46%)
coiled coil 320..389 CDD:269866 31/68 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576611
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 1 1.000 - - FOG0001412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.