DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and Mafb

DIOPT Version :9

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_062189.1 Gene:Mafb / 54264 RGDID:2982 Length:323 Species:Rattus norvegicus


Alignment Length:92 Identity:45/92 - (48%)
Similarity:67/92 - (72%) Gaps:2/92 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKKSYEW 92
            :||.|||:|||:|||.|  ||..::|::|:||:||||||||||.|||.||::||..||.:|:...
  Rat   212 SDDQLVSMSVRELNRHL--RGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLI 274

  Fly    93 TELEQMHEDNEQVRREVSNWKNKYKAL 119
            .::||:.::..::.||...:|.|.:.|
  Rat   275 QQVEQLKQEVSRLARERDAYKVKCEKL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 31/69 (45%)
coiled coil 59..110 CDD:269865 25/50 (50%)
MafbNP_062189.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..78
Maf_N 81..113 CDD:400609
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..209
bZIP_Maf_large 233..302 CDD:269866 31/69 (45%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 238..263 18/24 (75%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 266..287 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337423
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.