DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and NRL

DIOPT Version :9

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:XP_011535103.2 Gene:NRL / 4901 HGNCID:8002 Length:339 Species:Homo sapiens


Alignment Length:91 Identity:41/91 - (45%)
Similarity:64/91 - (70%) Gaps:6/91 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKKSYEW 92
            :|..|||:|||:|||  ::||..|:|.:|:|||||||||||||.:||.||::|:..||.:::...
Human   235 SDAALVSMSVRELNR--QLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLA 297

  Fly    93 TELEQMHEDNEQVRREVSNWKNKYKA 118
            .:|:.:..:..::.||    ::.|||
Human   298 AQLDALRAEVARLARE----RDLYKA 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 29/68 (43%)
coiled coil 59..110 CDD:269865 22/50 (44%)
NRLXP_011535103.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143693
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.